General Information

  • ID:  hor006693
  • Uniprot ID:  Q9IA10
  • Protein name:  GnRH-associated peptide 1
  • Gene name:  gnrh1
  • Organism:  Dicentrarchus labrax (European seabass) (Morone labrax)
  • Family:  GnRH family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Dicentrarchus (genus), Moronidae (family), Eupercaria incertae sedis, Eupercaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  ELDGLSETLGNQIVGSFPHVATPCRVLGCAEESPFPKIYRMKGFLDAVTDRENGNRTYKK
  • Length:  60
  • Propeptide:  MAAQTFALRLLLVGTLLGTLLGQGCCQHWSYGLSPGGKRELDGLSETLGNQIVGSFPHVATPCRVLGCAEESPFPKIYRMKGFLDAVTDRENGNRTYKK
  • Signal peptide:  MAAQTFALRLLLVGTLLGTLLGQGCC
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates the secretion of gonadotropins.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9IA10-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006693_AF2.pdbhor006693_ESM.pdb

Physical Information

Mass: 771010 Formula: C292H462N82O90S3
Absent amino acids: W Common amino acids: GEL
pI: 7.25 Basic residues: 9
Polar residues: 20 Hydrophobic residues: 17
Hydrophobicity: -49.83 Boman Index: -11745
Half-Life: 1 hour Half-Life Yeast: 30 min
Half-Life E.Coli: >10 hour Aliphatic Index 69.83
Instability Index: 1964.17 Extinction Coefficient cystines: 3105
Absorbance 280nm: 52.63

Literature

  • PubMed ID:  11086295
  • Title:  Differential expression of three different prepro-GnRH (gonadotrophin-releasing hormone) messengers in the brain of the european sea bass (Dicentrarchus labrax).